Overview of TH9507 – Tesa 10mg
Are you looking to buy TH9507 – Tesa 10mg for your laboratory research? You have come to the right place. This high-purity premium research peptide is currently in stock and available for sale at competitive wholesale pricing. Our TH9507 – Tesa 10mg is strictly manufactured under stringent quality control protocols to ensure top-tier scientific integrity and reproducible experimental results.
When searching for premium peptides online, researchers require high purity, verified analytical test results, and reliable delivery. We provide authentic, high-grade chemicals tailored for advanced laboratory testing, in vitro assays, and chemical analysis. Review our comprehensive inventory to buy top-rated products with complete confidence today.
Key Features & Product Specifications
Our company offers top-quality compounds optimized for clinical and laboratory trials. Below is the detailed specifications table for your review prior to purchase:
| Parameter | Specification / Detail |
|---|---|
| Product Name | TH9507 – Tesa 10mg |
| SKU | my-1779483745629-3 |
| CAS Number | 218949-48-5 |
| Molecular Formula | C₂₂₃H₃₇₀N₇₂O₆₉S |
| Molecular Weight | 5195.9 g/mol |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| Purity Level | ≥99% (HPLC Verified) |
| Format | White to off-white lyophilized powder |
| Availability | In Stock & Ready to Ship |
Why Purchase TH9507 – Tesa 10mg From Us?
We are a leading supplier of premium laboratory supplies and chemical components. When you choose to order from us, you get access to the best prices online, exceptional customer service, and reliable overnight shipping options. This product is for sale to institutional buyers, independent researchers, and analytical testing laboratories globally.
Every single batch undergoes high-performance liquid chromatography (HPLC) and mass spectrometry (MS) validation to verify sequence accuracy and maximum purity compliance. We minimize contaminants and moisture levels to provide maximum chemical stability over long-term storage periods.
Storage, Handling, and Stability Protocols
To preserve the optimal structural integrity and enzymatic activity of TH9507 – Tesa 10mg, it must be stored according to strict scientific guidelines:
- Keep stored at -20°C to -80°C for extended preservation.
- Avoid frequent freeze-thaw cycles by aliquoting into single-use experimental volumes.
- Protect fully from direct UV light exposure, high humidity levels, and excessive heat environments.
Explore More Premium Research Peptides
We invite you to browse through our extensive product list. Check out other top-tier options currently available in our store:
- Go to Homepage – Premium Research Supplies
- Buy Thymosin Alpha-1 10mg Online
- Buy 5-Amino-1MQ 10mg Online
- Buy Acetic Acid 0.6% 10ml Online
- Buy AOD-9604 5mg Online
- Buy B12 MIC Complex 10ml Online
For deep technical insights and authoritative literature references, you can review peer-reviewed studies on the National Center for Biotechnology Information (NCBI) PubChem Database.
Strict Research Use Only Disclaimer
IMPORTANT NOTE: This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro laboratory experimentation and scientific research by qualified professionals. It is not a human drug, veterinary drug, food product, cosmetic, or dietary supplement, and has not been evaluated or approved by the Food and Drug Administration (FDA). This peptide is not intended to diagnose, treat, cure, mitigate, or prevent any medical condition or disease. The bodily introduction, injection, ingestion, or inhalation into humans or animals is strictly prohibited by law. Any misuse, misbranding, or unauthorized redistribution is a direct violation of regulatory protocols and may lead to formal legal action under applicable state and federal guidelines.
