Overview of Cagrilintide 5mg
Are you looking to buy Cagrilintide 5mg for your laboratory research? You have come to the right place. This high-purity premium research peptide is currently in stock and available for sale at competitive wholesale pricing. Our Cagrilintide 5mg is strictly manufactured under stringent quality control protocols to ensure top-tier scientific integrity and reproducible experimental results.
When searching for premium peptides online, researchers require high purity, verified analytical test results, and reliable delivery. We provide authentic, high-grade chemicals tailored for advanced laboratory testing, in vitro assays, and chemical analysis. Review our comprehensive inventory to buy top-rated products with complete confidence today.
Key Features & Product Specifications
Our company offers top-quality compounds optimized for clinical and laboratory trials. Below is the detailed specifications table for your review prior to purchase:
| Parameter | Specification / Detail |
|---|---|
| Product Name | Cagrilintide 5mg |
| SKU | my-1779483748189-11 |
| CAS Number | 1415456-99-3 |
| Molecular Formula | C₁₇₄H₂₇₆N₅₂O₅₅ |
| Molecular Weight | 3946.32 g/mol |
| Sequence | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity) |
| Purity Level | ≥99% (HPLC Verified) |
| Format | White to off-white lyophilized powder |
| Availability | In Stock & Ready to Ship |
Why Purchase Cagrilintide 5mg From Us?
We are a leading supplier of premium laboratory supplies and chemical components. When you choose to order from us, you get access to the best prices online, exceptional customer service, and reliable overnight shipping options. This product is for sale to institutional buyers, independent researchers, and analytical testing laboratories globally.
Every single batch undergoes high-performance liquid chromatography (HPLC) and mass spectrometry (MS) validation to verify sequence accuracy and maximum purity compliance. We minimize contaminants and moisture levels to provide maximum chemical stability over long-term storage periods.
Storage, Handling, and Stability Protocols
To preserve the optimal structural integrity and enzymatic activity of Cagrilintide 5mg, it must be stored according to strict scientific guidelines:
- Keep stored at -20°C to -80°C for extended preservation.
- Avoid frequent freeze-thaw cycles by aliquoting into single-use experimental volumes.
- Protect fully from direct UV light exposure, high humidity levels, and excessive heat environments.
Explore More Premium Research Peptides
We invite you to browse through our extensive product list. Check out other top-tier options currently available in our store:
- Go to Homepage – Premium Research Supplies
- Buy Cerebrolysin 60mg Online
- Buy CJC-1295 DAC 5mg Online
- Buy CJC-1295 no DAC 5mg (Mod GRF 1-29) Online
- Buy CJC/IPA Blend 5/5mg Online
- Buy DSIP 5mg Online
For deep technical insights and authoritative literature references, you can review peer-reviewed studies on the National Center for Biotechnology Information (NCBI) PubChem Database.
Strict Research Use Only Disclaimer
IMPORTANT NOTE: This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro laboratory experimentation and scientific research by qualified professionals. It is not a human drug, veterinary drug, food product, cosmetic, or dietary supplement, and has not been evaluated or approved by the Food and Drug Administration (FDA). This peptide is not intended to diagnose, treat, cure, mitigate, or prevent any medical condition or disease. The bodily introduction, injection, ingestion, or inhalation into humans or animals is strictly prohibited by law. Any misuse, misbranding, or unauthorized redistribution is a direct violation of regulatory protocols and may lead to formal legal action under applicable state and federal guidelines.
